PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004042.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 224aa    MW: 26051.5 Da    PI: 9.1236
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004042.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR133.31.6e-1034764991
                     FAR1 49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                             +++   +  tr +C+a+ + +++++gkw+vtk ++eHnHel+p
  Itr_sc004042.1_g00002.1 34 VNKCYAKIDTRSECNAMCQFNLDSSGKWVVTKHVKEHNHELCP 76
                             356678899********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.4E-83576IPR004330FAR1 DNA binding domain
PfamPF105514.5E-21110183IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVVILLLEVV VLLQMPMRRI HLFQAGFKAK PESVNKCYAK IDTRSECNAM CQFNLDSSGK  60
WVVTKHVKEH NHELCPPSAS YMLRSHRNVS VAQLTYLKDM KRSGVPLSDG MNHHCMNVMF  120
GCGFLLNERT ESFVWLFKTF LQSMDGRQPQ TIMTYQCSVM AVAIMQVFPN SRHRLCIWHI  180
GENSKKHIIK GLRIQKGFIE LFNFLLKSSD TEAEFEFYWN SMQF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010669163.11e-42PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.16e-22FAR1 family protein